PDB entry 3vhl

View 3vhl on RCSB PDB site
Description: Crystal structure of the DHR-2 domain of DOCK8 in complex with Cdc42 (T17N mutant)
Class: signaling protein
Keywords: signal transduction, guanine nucleotide exchang factor, GTPase, SIGNALING PROTEIN
Deposited on 2011-08-26, released 2012-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dedicator of cytokinesis protein 8
    Species: Mus musculus [TaxId:10090]
    Gene: Dock8
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (7-End)
      • engineered mutation (23)
    Domains in SCOPe 2.06: d3vhlb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3vhlB (B:)
gssgssgmqtikcvvvgdgavgkncllisyttnkfpseyvptvfdnyavtvmiggepytl
glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
laaleppepkksrrs

    Sequence, based on observed residues (ATOM records): (download) 
    >3vhlB (B:)
mqtikcvvvgdgavgkncllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale