PDB entry 3vhi

View 3vhi on RCSB PDB site
Description: Crystal structure of monoZ-biotin-avidin complex
Class: biotin-binding protein
Keywords: beta barrel, BIOTIN-BINDING PROTEIN
Deposited on 2011-08-25, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vhia_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vhib_
  • Chain 'C':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vhic_
  • Chain 'D':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vhid_
  • Heterogens: VHI, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vhiA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vhiB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhiB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vhiC (C:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vhiD (D:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vhiD (D:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l