PDB entry 3vgw

View 3vgw on RCSB PDB site
Description: Crystal structure of monoAc-biotin-avidin complex
Class: biotin-binding protein
Keywords: beta barrel, BIOTIN-BINDING PROTEIN
Deposited on 2011-08-21, released 2011-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwa_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwb_
  • Chain 'C':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwc_
  • Chain 'D':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwd_
  • Chain 'E':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwe_
  • Chain 'F':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwf_
  • Chain 'G':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwg_
  • Chain 'H':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3vgwh_
  • Heterogens: NVZ, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vgwA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vgwB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgwB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vgwC (C:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vgwD (D:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgwD (D:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vgwE (E:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vgwF (F:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgwF (F:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vgwG (G:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3vgwH (H:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgwH (H:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l