PDB entry 3vgd

View 3vgd on RCSB PDB site
Description: Ctystal structure of glycosyltrehalose trehalohydrolase (D252E)
Class: hydrolase
Keywords: alpha/beta barrel, trehalose, trehalohydrolase, alpha-amylase, HYDROLASE
Deposited on 2011-08-09, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malto-oligosyltrehalose trehalohydrolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: treZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55088
      • engineered mutation (251)
    Domains in SCOPe 2.07: d3vgda1, d3vgda2, d3vgda3
  • Heterogens: FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vgdA (A:)
    tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
    ddaseipdpasryqpegvhgpsqiiqeskefnnetflkkedliiyeihvgtftpegtfeg
    virkldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkk
    glgvildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveyw
    ikeynvdgfrleavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekcgy
    nidaqwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgep
    vgeldgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeyg
    eenpfyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykil
    ikmrkelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpq
    hieegkyefdkgfalykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vgdA (A:)
    aykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldd
    aseipdpasryqpegvhgpsqiiqesfnnetflkkedliiyeihvgtftpegtfegvirk
    ldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkkglgv
    ildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveywikey
    nvdgfrleavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekcgynida
    qwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgepvgel
    dgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeygeenp
    fyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykilikmr
    kelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhiee
    gkyefdkgfalyk