PDB entry 3vfa
View 3vfa on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant V82A with novel P1'-Ligands GRL-02031
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor,P1'-ligand, hydrolase-hydrolase inhibitor complex
Deposited on
2012-01-09, released
2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-11-21, with a file datestamp of
2012-11-16.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.17
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P0C6F2 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (81)
- engineered mutation (94)
Domains in SCOPe 2.04: d3vfaa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P0C6F2 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (81)
- engineered mutation (94)
Domains in SCOPe 2.04: d3vfab_ - Heterogens: 031, NA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3vfaA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3vfaB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf