PDB entry 3vfa

View 3vfa on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant V82A with novel P1'-Ligands GRL-02031
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor,P1'-ligand, hydrolase-hydrolase inhibitor complex
Deposited on 2012-01-09, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.17
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6F2 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (81)
      • engineered mutation (94)
    Domains in SCOPe 2.04: d3vfaa_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6F2 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (81)
      • engineered mutation (94)
    Domains in SCOPe 2.04: d3vfab_
  • Heterogens: 031, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vfaA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vfaB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf