PDB entry 3vf7

View 3vf7 on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant L76V with novel P1'-Ligands GRL-02031
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor,P1'-ligand, hydrolase-hydrolase inhibitor complex
Deposited on 2012-01-09, released 2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (75)
      • engineered mutation (94)
    Domains in SCOPe 2.04: d3vf7a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (75)
      • engineered mutation (94)
    Domains in SCOPe 2.04: d3vf7b_
  • Heterogens: 031, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vf7A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vf7B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf