PDB entry 3vf7
View 3vf7 on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant L76V with novel P1'-Ligands GRL-02031
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor,P1'-ligand, hydrolase-hydrolase inhibitor complex
Deposited on
2012-01-09, released
2012-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-11-28, with a file datestamp of
2012-11-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.158
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (75)
- engineered mutation (94)
Domains in SCOPe 2.04: d3vf7a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1 (BRU ISOLATE) [TaxId:11686]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered mutation (6)
- engineered mutation (32)
- engineered mutation (62)
- engineered mutation (66)
- engineered mutation (75)
- engineered mutation (94)
Domains in SCOPe 2.04: d3vf7b_ - Heterogens: 031, NA, CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3vf7A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3vf7B (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf