PDB entry 3vf0

View 3vf0 on RCSB PDB site
Description: Raver1 in complex with metavinculin L954 deletion mutant
Class: cell adhesion/protein binding
Keywords: cytoskeletal F-actin binding protein, ribonucleoprotein, CELL ADHESION-PROTEIN BINDING complex
Deposited on 2012-01-09, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3vf0a_
  • Chain 'B':
    Compound: Ribonucleoprotein PTB-binding 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1978, RAVER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IY67 (2-End)
      • cloning artifact (0-1)
  • Heterogens: EPE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vf0A (A:)
    gshmdelappkpplpegevppprppppeekdeefpeqkagevinqpmmmaarqlhdeark
    wsskpgipaaevgigvvaeadaadaagfpvppdmeddyepelllmpsnqpvnqpilaaaq
    slhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqcakdiakasdevtr
    lakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtnisdeeseqateml
    vhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vf0A (A:)
    psnqpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkrali
    qcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgr
    tnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq
    

  • Chain 'B':
    No sequence available.