PDB entry 3vec

View 3vec on RCSB PDB site
Description: Rhodococcus jostii RHA1 DypB D153A variant in complex with heme
Class: oxidoreductase
Keywords: peroxidase, lignan, Dyp, OXIDOREDUCTASE
Deposited on 2012-01-07, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DypB
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: DyPB, RHA1_ro02407
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SE24
      • engineered mutation (155)
    Domains in SCOPe 2.07: d3veca_
  • Chain 'B':
    Compound: DypB
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: DyPB, RHA1_ro02407
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SE24
      • engineered mutation (155)
    Domains in SCOPe 2.07: d3vecb_
  • Chain 'C':
    Compound: DypB
    Species: Rhodococcus jostii [TaxId:101510]
    Gene: DyPB, RHA1_ro02407
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0SE24
      • engineered mutation (155)
    Domains in SCOPe 2.07: d3vecc_
  • Heterogens: HEM, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vecA (A:)
    gshmpgpvarlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrel
    agslscvvgvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcf
    elgrqivsalgsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfr
    ggsyvivqkylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddg
    vehdilrdnmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaa
    tgtlffvpsrdvleslgdepagaesapedpvepaaagpydlslkigglkgvsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vecA (A:)
    arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv
    gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs
    algsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfrggsyvivq
    kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilrd
    nmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp
    srdvlesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vecB (B:)
    gshmpgpvarlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrel
    agslscvvgvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcf
    elgrqivsalgsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfr
    ggsyvivqkylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddg
    vehdilrdnmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaa
    tgtlffvpsrdvleslgdepagaesapedpvepaaagpydlslkigglkgvsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vecB (B:)
    arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv
    gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs
    algsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfrggsyvivq
    kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilrd
    nmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp
    srdvleslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vecC (C:)
    gshmpgpvarlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrel
    agslscvvgvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcf
    elgrqivsalgsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfr
    ggsyvivqkylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddg
    vehdilrdnmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaa
    tgtlffvpsrdvleslgdepagaesapedpvepaaagpydlslkigglkgvsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vecC (C:)
    arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv
    gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs
    algsaatvvdevhgfryfdsrdllgfvagtenptdddaadsaligdedpdfrggsyvivq
    kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilrd
    nmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp
    srdvleslg