PDB entry 3vc0

View 3vc0 on RCSB PDB site
Description: Crystal structure of Taipoxin beta subunit isoform 1
Class: toxin
Keywords: phospholipase A2 fold, PLA2 fold, neurotoxin, phospholipase, Calcium binding, Taipoxin alpha subunit binding, Taipoxin gamma subunit binding, secreted, TOXIN
Deposited on 2012-01-03, released 2012-07-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog, taipoxin beta chain
    Species: Oxyuranus scutellatus scutellatus [TaxId:8667]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vc0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3vc0A (A:)
nlvqfgkmiecairnrrpaldfmnygcycgkggsgtpvddldrccqvhdecyaeaekhgc
ypslttytwecrqvgpycnsktqcevfvcacdfaaakcfaqedynpahsnintgerck