PDB entry 3vbz

View 3vbz on RCSB PDB site
Description: Crystal structure of Taipoxin beta subunit isoform 2
Class: toxin
Keywords: phospholipase A2 fold, PLA2 fold, neurotoxin, phospholipase, Calcium binding, Taipoxin alpha subunit binding, Taipoxin gamma subunit binding, secreted, TOXIN
Deposited on 2012-01-03, released 2012-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 homolog, taipoxin beta chain
  Species: Oxyuranus scutellatus scutellatus [TaxId:8667]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00615 (0-117)
    • variant (6)
    • variant (30-31)
    • variant (33)
    • variant (53)
    • variant (67)
    • variant (75-76)
    • variant (92)
    • variant (98)
    • variant (108)
  Domains in SCOPe 2.08: d3vbza_
• Chain 'B':
  Compound: Phospholipase A2 homolog, taipoxin beta chain
  Species: Oxyuranus scutellatus scutellatus [TaxId:8667]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00615 (0-117)
    • variant (6)
    • variant (30-31)
    • variant (33)
    • variant (53)
    • variant (67)
    • variant (75-76)
    • variant (92)
    • variant (98)
    • variant (108)
  Domains in SCOPe 2.08: d3vbzb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vbzA (A:)
  nlvqfgfmiecairnrrpaldfmnygcycgtvgrgtpvddldrccqvhdecyataekhgc
  ypslttyqwecrqvgnecnsktqcevfvcacdlaaakclaqedynpahfnintgerck
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vbzB (B:)
  nlvqfgfmiecairnrrpaldfmnygcycgtvgrgtpvddldrccqvhdecyataekhgc
  ypslttyqwecrqvgnecnsktqcevfvcacdlaaakclaqedynpahfnintgerck