PDB entry 3vbw

View 3vbw on RCSB PDB site
Description: Exploitation of hydrogen bonding constraints and flat hydrophobic energy landscapes in Pim-1 kinase needle screening and inhibitor design
Class: transferase/transferase inhibitor
Keywords: Pim1, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-02, released 2012-03-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3vbwa_
  • Heterogens: 0FN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vbwA (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskaaalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbwA (A:)
    esqyqvgpllggsvysgirvsdnlpvaikhvekdrisdwgeltrvpmevvllkkvssgfs
    gvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchnc
    gvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgr
    saavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptf
    eeiqnhpwmqdvllpqetaeihlh