PDB entry 3vbo

View 3vbo on RCSB PDB site
Description: Crystal structure of formaldehyde treated empty human Enterovirus 71 particle (cryo at 100K)
Class: virus
Keywords: virus, hand-foot-and-mouth disease, enterovirus uncoating, pocket factor, adaptor-sensor, icosahedral virus
Deposited on 2012-01-02, released 2012-02-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome Polyprotein, capsid protein VP1
    Species: Human enterovirus 71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2ZUN0 (Start-296)
      • see remark 999 (224)
  • Chain 'B':
    Compound: Genome Polyprotein, capsid protein VP2
    Species: Human enterovirus 71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vbob_
  • Chain 'C':
    Compound: Genome Polyprotein, capsid protein VP3
    Species: Human enterovirus 71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3vboc_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vboB (B:)
    vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
    ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
    gtvaggtgtedthppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
    iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vboC (C:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtg