PDB entry 3vbh

View 3vbh on RCSB PDB site
Description: Crystal structure of formaldehyde treated human enterovirus 71 (space group R32)
Class: virus
Keywords: virus, hand-foot-and-mouth disease, enterovirus uncoating, pocket factor, adaptor-sensor, icosahedral virus
Deposited on 2012-01-02, released 2012-02-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Genome Polyprotein, capsid protein VP1
  Species: Human enterovirus 71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (0-296)
    • see remark 999 (224)
  Domains in SCOPe 2.04: d3vbha_
• Chain 'B':
  Compound: Genome Polyprotein, capsid protein VP2
  Species: Human enterovirus 71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN1 (0-244)
• Chain 'C':
  Compound: Genome Polyprotein, vapsid protein VP3
  Species: Human enterovirus 71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (0-241)
  Domains in SCOPe 2.04: d3vbhc_
• Chain 'D':
  Compound: Genome Polyprotein, capsid protein VP4
  Species: Human enterovirus 71 [TaxId:39054]
  Database cross-references and differences (RAF-indexed):
  • Uniprot B2ZUN0 (0-57)
• Heterogens: SPH, K, NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vbhA (A:)
  gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
  esmietrcvlnshstaettldsffsraglvgeidlplkgttnpngyanwdiditgyaqmr
  rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
  vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygampnnmmgtfsvrtvgt
  skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vbhC (C:)
  gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
  natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
  ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
  ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
  iq
  

  
  
• Chain 'D':
  No sequence available.