PDB entry 3vbg

View 3vbg on RCSB PDB site
Description: Structure of hDM2 with Dimer Inducing Indolyl Hydantoin RO-2443
Class: Ligase/ligase activator
Keywords: Ligase, MDM2, MDMX, P53, Ligase-ligase activator complex
Deposited on 2012-01-02, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (Start-84)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3vbga_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3vbgb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (Start-84)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3vbgc_
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (0-84)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d3vbgd_
  • Heterogens: 03M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vbgA (A:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbgA (A:)
    tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
    fgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vbgB (B:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vbgC (C:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbgC (C:)
    tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
    fgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vbgD (D:)
    etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv