PDB entry 3vba

View 3vba on RCSB PDB site
Description: Crystal structure of methanogen 3-isopropylmalate isomerase small subunit
Class: Lyase
Keywords: Lyase, LeuD, cytosol
Deposited on 2012-01-02, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58673 (0-167)
      • expression tag (168)
    Domains in SCOPe 2.07: d3vbaa1, d3vbaa2
  • Chain 'B':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58673 (0-167)
      • expression tag (168)
    Domains in SCOPe 2.07: d3vbab1, d3vbab2
  • Chain 'C':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vbac_
  • Chain 'D':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vbad_
  • Chain 'E':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vbae_
  • Chain 'F':
    Compound: Isopropylmalate/citramalate isomerase small subunit
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: leuD, MJ1277
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vbaf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vbaA (A:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaA (A:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vbaB (B:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaB (B:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vbaC (C:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaC (C:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vbaD (D:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaD (D:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vbaE (E:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaE (E:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkma
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vbaF (F:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmaesqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vbaF (F:)
    mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
    knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
    evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkma