PDB entry 3vb2

View 3vb2 on RCSB PDB site
Description: Crystal Structure of the Reduced Form of MarR from E.coli
Class: transcription regulator
Keywords: Winged Helix-turn-Helix DNA-binding motif, transcription regulator
Deposited on 2011-12-30, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.245
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27245 (Start-143)
      • engineered mutation (46)
      • engineered mutation (50)
      • engineered mutation (53)
      • engineered mutation (79)
      • engineered mutation (107)
      • engineered mutation (110)
    Domains in SCOPe 2.08: d3vb2a_
  • Chain 'B':
    Compound: multiple antibiotic resistance protein marr
    Species: Escherichia coli [TaxId:83333]
    Gene: b1530, cfxB, inaR, JW5248, marR, soxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27245 (Start-143)
      • engineered mutation (46)
      • engineered mutation (50)
      • engineered mutation (53)
      • engineered mutation (79)
      • engineered mutation (107)
      • engineered mutation (110)
    Domains in SCOPe 2.08: d3vb2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vb2A (A:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvel
    kkvlsvdlgaltrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vb2A (A:)
    neiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvlsvdl
    galtrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqeltknlt
    adevatleyllkkvlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vb2B (B:)
    mkstsdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvel
    kkvlsvdlgaltrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlh
    qeltknltadevatleyllkkvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vb2B (B:)
    sdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvl
    svdlgaltrmldrlvskgwverlpnvlvklttggaaiseqshqlvgqdlhqeltknltad
    evatleyllkkvlp