PDB entry 3vay

View 3vay on RCSB PDB site
Description: Crystal structure of 2-Haloacid Dehalogenase from Pseudomonas syringae pv. Tomato DC3000
Class: hydrolase
Keywords: Rossmann fold, haloacid dehalogenase, HYDROLASE
Deposited on 2011-12-30, released 2013-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HAD-superfamily hydrolase
    Species: Pseudomonas syringae pv. tomato [TaxId:223283]
    Gene: PSPTO_0221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vaya_
  • Chain 'B':
    Compound: HAD-superfamily hydrolase
    Species: Pseudomonas syringae pv. tomato [TaxId:223283]
    Gene: PSPTO_0221
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3vayb_
  • Heterogens: MG, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vayA (A:)
    miklvtfdlddtlwdtapaivgaeaalrdwlaeqapklgpvpvehlweirsrlldedpsf
    khrisalrrrvlfhaledagydsdeaqqladesfevflhgrhqvqifpevqptleilakt
    ftlgvitngnadvrrlgladyfafalcaedlgigkpdpapflealrrakvdasaavhvgd
    hpsddiagaqqagmraiwynpqgkawdadrlpdaeihnlsqlpevlarwa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3vayB (B:)
    miklvtfdlddtlwdtapaivgaeaalrdwlaeqapklgpvpvehlweirsrlldedpsf
    khrisalrrrvlfhaledagydsdeaqqladesfevflhgrhqvqifpevqptleilakt
    ftlgvitngnadvrrlgladyfafalcaedlgigkpdpapflealrrakvdasaavhvgd
    hpsddiagaqqagmraiwynpqgkawdadrlpdaeihnlsqlpevlarwa