PDB entry 3vav

View 3vav on RCSB PDB site
Description: Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from Burkholderia thailandensis
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Burkolderia thailandensis, melioidosis, Ketopantoate hydroxymethyltransferase (KPHMT), transferase
Deposited on 2011-12-29, released 2012-01-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vava_
  • Chain 'B':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavb_
  • Chain 'C':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavc_
  • Chain 'D':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavd_
  • Chain 'E':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vave_
  • Chain 'F':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavf_
  • Chain 'G':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavg_
  • Chain 'H':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavh_
  • Chain 'I':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavi_
  • Chain 'J':
    Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I1311, panB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3vavj_
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3vavA (A:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavA (A:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafgvqgkteagaaqllrdaraveeagaqlivleav
    ptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaa
    veayvravkdgsfpgpehsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3vavB (B:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavB (B:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeagaqlivl
    eavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfrprfvkdfmqgqpsifaa
    veayvravkdgsfpgpehsf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3vavC (C:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavC (C:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvggaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
    hsf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3vavD (D:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavD (D:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafvqgkteagaaqllrdaraveeagaqlivleavp
    tlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaav
    eayvravkdgsfpgpehsf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3vavE (E:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavE (E:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsteagaaqllrdaraveeagaqlivleavptlvaaevt
    relsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravk
    dgsfpgpehsf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3vavF (F:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavF (F:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafgteagaaqllrdaraveeagaqlivleavptlv
    aaevtrelsiptigigagaecsgqvlvlhdmlgvfrprfvkdfmqgqpsifaaveayvra
    vkdgsfpgpehsf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3vavG (G:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavG (G:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvggaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
    gigagaecsgqvlvlhdmlgvfprfvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3vavH (H:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavH (H:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeagaqlivl
    eavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsi
    faaveayvravkdgsfpgpehsf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3vavI (I:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavI (I:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgeagaaqllrdaraveeagaqlivleavptlvaaevtrelsip
    tigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpg
    pehsf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3vavJ (J:)
    gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
    nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
    qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
    aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
    fvkdfmqgqpsifaaveayvravkdgsfpgpehsf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3vavJ (J:)
    rpavtvpklqamreagekiamltcydasfaalldranvdvqligdslgnvlqgqtttlpv
    tlddiayhtacvaraqpralivadlpfgtygtpadafasavklmragaqmvkfeggewla
    etvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeagaqlivl
    eavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsi
    faaveayvravkdgsfpgpehsf