SCOPe 2.02: Structural Classification of Proteins

PDB entry 3vav

View 3vav on RCSB PDB site
Description: Crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from Burkholderia thailandensis
Class: transferase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Burkolderia thailandensis, melioidosis, Ketopantoate hydroxymethyltransferase (KPHMT), transferase
Deposited on 2011-12-29, released 2012-01-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vava_
Chain 'B':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavb_
Chain 'C':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavc_
Chain 'D':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavd_
Chain 'E':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vave_
Chain 'F':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavf_
Chain 'G':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavg_
Chain 'H':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavh_
Chain 'I':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavi_
Chain 'J':
Compound: 3-methyl-2-oxobutanoate hydroxymethyltransferase
Species: Burkholderia thailandensis [TaxId:271848]
Gene: BTH_I1311, panB
Database cross-references and differences (RAF-indexed):
- Uniprot Q2SYZ1 (Start-274)
Domains in SCOPe 2.02: d3vavj_
Heterogens: EDO, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3vavA (A:)
gpgsmtylqessrpavtvpklqamreagekiamltcydasfaalldranvdvqligdslg
nvlqgqtttlpvtlddiayhtacvaraqpralivadlpfgtygtpadafasavklmraga
qmvkfeggewlaetvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdar
aveeagaqlivleavptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrpr
fvkdfmqgqpsifaaveayvravkdgsfpgpehsf