PDB entry 3va2

View 3va2 on RCSB PDB site
Description: Crystal structure of human Interleukin-5 in complex with its alpha receptor
Class: cytokine/cytokine receptor
Keywords: cytokine, eosinophilic, asthma, JAK/STAT, fibronectin III-like (Fn III) domain, canonical cytokine receptor homology module (CRM), B cell growth, Ig secretion, eosinophils proliferation, cell surface, CYTOKINE-CYTOKINE RECEPTOR complex
Deposited on 2011-12-28, released 2012-07-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interleukin-5
  Species: Homo sapiens [TaxId:9606]
  Gene: Il5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05113
• Chain 'B':
  Compound: Interleukin-5
  Species: Homo sapiens [TaxId:9606]
  Gene: Il5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05113
  Domains in SCOPe 2.02: d3va2b_
• Chain 'C':
  Compound: Interleukin-5 receptor subunit alpha
  Species: Homo sapiens [TaxId:9606]
  Gene: IL5RA, IL5R
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01344
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3va2B (B:)
  gssgssgeiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtle
  sqtvqggtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiies
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3va2B (B:)
  iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
  verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewii
  

  
  
• Chain 'C':
  No sequence available.