PDB entry 3v9p

View 3v9p on RCSB PDB site
Description: Crystal structure of Thymidylate kinase from Burkholderia thailandensis
Class: transferase
Keywords: SSGCID, Thymidylate kinase, Burkholderia thailandensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2011-12-27, released 2012-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I2154, tmk, YP_442675.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3v9pa_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I2154, tmk, YP_442675.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3v9pb_
  • Heterogens: MRD, GOL, ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v9pA (A:)
    mahhhhhhmgtleaqtqgpgsmargkfitfegidgagktthlqwfcdrlqerlgpagrhv
    vvtrepggtrlgetlreillnqpmdleteallmfagrrehlalviepalargdwvvsdrf
    tdatfayqgggrglprdklealerwvqggfqpdltvlfdvppqiasarrgavrmpdkfes
    esdaffartraeylrraqeaphrfvivdssepiaqirkqlegvlaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9pA (A:)
    argkfitfegidktthlqwfcdrlqerlgpagrhvvvtrepggtrlgetlreillnqpmd
    leteallmfagrrehlalviepalargdwvvsdrftdatfayqgggrglprdklealerw
    vqggfqpdltvlfdvppqiasarrgavrmpesesdaffartraeylrraqeaphrfvivd
    ssepiaqirkqlegvlaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v9pB (B:)
    mahhhhhhmgtleaqtqgpgsmargkfitfegidgagktthlqwfcdrlqerlgpagrhv
    vvtrepggtrlgetlreillnqpmdleteallmfagrrehlalviepalargdwvvsdrf
    tdatfayqgggrglprdklealerwvqggfqpdltvlfdvppqiasarrgavrmpdkfes
    esdaffartraeylrraqeaphrfvivdssepiaqirkqlegvlaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v9pB (B:)
    argkfitfegidktthlqwfcdrlqerlgpagrhvvvtrepggtrlgetlreillnqpmd
    leteallmfagrrehlalviepalargdwvvsdrftdatfayqgggrglprdklealerw
    vqggfqpdltvlfdvppqiasarrgavrmpdkfesesdaffartraeylrraqeaphrfv
    ivdssepiaqirkqlegvlaal