PDB entry 3v8d

View 3v8d on RCSB PDB site
Description: Crystal structure of human CYP7A1 in complex with 7-ketocholesterol
Class: oxidoreductase
Keywords: cytochrome, OXIDOREDUCTASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2011-12-22, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholesterol 7-alpha-monooxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP7A1, CYP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22680 (7-485)
      • expression tag (6)
      • engineered mutation (86)
      • expression tag (486-487)
    Domains in SCOPe 2.07: d3v8da1, d3v8da2, d3v8da3
  • Chain 'B':
    Compound: Cholesterol 7-alpha-monooxygenase
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP7A1, CYP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22680 (7-End)
      • expression tag (6)
      • engineered mutation (86)
    Domains in SCOPe 2.07: d3v8db1, d3v8db2
  • Heterogens: HEM, 0GV, SO4, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v8dA (A:)
    makktssrrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvh
    fitnplsyhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqgha
    lnsltesmmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdt
    qkahilnnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiseli
    slrmflndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkr
    tlenagqkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledg
    synirkddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympf
    gsgaticpgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndief
    kykfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v8dA (A:)
    srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
    syhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnslte
    smmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahil
    nnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmfl
    ndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenag
    qkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirk
    ddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgati
    cpgrlfaiheikqflilmlsyfeleliakcppldqsraglgilpplndiefkykfkhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v8dB (B:)
    makktssrrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvh
    fitnplsyhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqgha
    lnsltesmmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdt
    qkahilnnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiseli
    slrmflndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkr
    tlenagqkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledg
    synirkddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympf
    gsgaticpgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndief
    kykfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v8dB (B:)
    srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
    syhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnslte
    smmenlqrimrppvaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnf
    kqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlst
    fddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslp
    iclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypq
    lmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaih
    eikqflilmlsyfeleliakcppldqsraglgilpplndiefkykfk