PDB entry 3v7v

View 3v7v on RCSB PDB site
Description: Thaumatin by Classical Hanging Drop Vapour Diffusion after 1.81 MGy X-Ray dose at ESRF ID29 beamline (Best Case)
Class: plant protein
Keywords: radiation damage, thin film, Langmuir-Blodgett, LB, PLANT PROTEIN
Deposited on 2011-12-22, released 2012-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thaumatin I
  Species: Thaumatococcus daniellii [TaxId:4621]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8RVT0 (0-206)
  Domains in SCOPe 2.08: d3v7va_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3v7vA (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpta