PDB entry 3v7j

View 3v7j on RCSB PDB site
Description: Co-crystal structure of Wild Type Rat polymerase beta: Enzyme-DNA binary complex
Class: Transferase/DNA
Keywords: Protein-DNA complex, repair polymerase, Transferase-DNA complex
Deposited on 2011-12-21, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POLB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v7ja1, d3v7ja2, d3v7ja3
  • Chain 'P':
    Compound: DNA (5'-d(p*ap*tp*gp*tp*gp*ap*gp*t)-3')
  • Chain 'T':
    Compound: DNA (5'-d(p*cp*ap*ap*ap*cp*tp*cp*ap*cp*ap*tp*a)-3')
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v7jA (A:)
    mghhhhhhrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiks
    gaeakklpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklv
    degiktledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyia
    tvcgsfrrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkf
    mgvcqlpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftine
    ytirplgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v7jA (A:)
    etlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
    iaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkn
    edklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaess
    gdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsenden
    eyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvag
    eplpvdseqdifdyiqwryrepkdrse
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.