PDB entry 3v6r

View 3v6r on RCSB PDB site
Description: Discovery of potent and selective covalent inhibitors of JNK
Class: transferase/transferase inhibitor
Keywords: KINASE FOLD, APOPTOSIS, MAP KINASE, CYS modification, Phosphorylation, JNK, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-12-20, released 2012-02-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3v6ra_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3v6rb_
  • Heterogens: CQQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v6rA (A:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6rA (A:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmvtry
    yrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmk
    klqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakri
    svddalqhpyinvwydpaeveapppqiqlderehtieewkeliykevmns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v6rB (B:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6rB (B:)
    dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
    akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
    rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfvtryyr
    apevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisv
    ddalqhpyinvwydpaeveapppqilderehtieewkeliykevmns