PDB entry 3v6o

View 3v6o on RCSB PDB site
Description: Leptin Receptor-antibody complex
Class: immune system
Keywords: Receptor-antibody complex, Cytokine receptor, Antibody Fab fragment, Immunoglobulin fold, Leptin Receptor-antibody complex, IMMUNE SYSTEM
Deposited on 2011-12-20, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leptin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: DB, LEPR, OBR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Leptin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: DB, LEPR, OBR
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Monoclonal antibody 9F8 fab fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6O (Start-220)
  • Chain 'D':
    Compound: Monoclonal antibody 9F8 fab fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6O
  • Chain 'E':
    Compound: Monoclonal antibody 9F8 fab fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6O (Start-214)
    Domains in SCOPe 2.07: d3v6oe1, d3v6oe2
  • Chain 'F':
    Compound: Monoclonal antibody 9F8 fab fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6O (Start-214)
    Domains in SCOPe 2.07: d3v6of1, d3v6of2
  • Heterogens: CYS, EDO, ACT, NA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3v6oE (E:)
    aeivmtqspkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvp
    arftgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6oE (E:)
    ivmtqspkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvpar
    ftgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3v6oF (F:)
    aeivmtqspkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvp
    arftgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v6oF (F:)
    ivmtqpkfmstsigdrvnitckatqnvrtavtwyqqkpgqspqaliflasnrhtgvparf
    tgsgsgtdftltinnvksedladyfclqhwnypltfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec