PDB entry 3v6f

View 3v6f on RCSB PDB site
Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound
Class: immune system
Keywords: immunoglobulin domain, antibody Fab fragment, IMMUNE SYSTEM
Deposited on 2011-12-19, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab e6 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-223)
  • Chain 'B':
    Compound: Fab e6 Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-218)
    Domains in SCOPe 2.07: d3v6fb1, d3v6fb2
  • Chain 'C':
    Compound: Fab e6 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-223)
  • Chain 'D':
    Compound: Fab e6 Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-218)
    Domains in SCOPe 2.07: d3v6fd1, d3v6fd2
  • Chain 'E':
    Compound: Fab e6 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-223)
  • Chain 'F':
    Compound: Fab e6 Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-218)
    Domains in SCOPe 2.07: d3v6ff1, d3v6ff2
  • Chain 'H':
    Compound: Fab e6 Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-223)
  • Chain 'L':
    Compound: Fab e6 Light Chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V6F (0-218)
    Domains in SCOPe 2.07: d3v6fl1, d3v6fl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v6fB (B:)
    nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v6fD (D:)
    nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v6fF (F:)
    nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v6fL (L:)
    nimmtqspsslavsagekvtmnckssqsvlyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltissvqtedlavyychqylssymytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrn