PDB entry 3v62

View 3v62 on RCSB PDB site
Description: Structure of the S. cerevisiae Srs2 C-terminal domain in complex with PCNA conjugated to SUMO on lysine 164
Class: protein binding/DNA binding protein
Keywords: UBIQUITIN-LIKE PROTEIN PCNA, POST-TRANSLATIONAL MODIFICATION DNA REPLICATION DNA DAMAGE RESPONSE, SRS2, NEM MODIFICATION ON PCNA CYS22 AND CYS81 REDUCTIVE METHYLATION OF ALL LYSINE RESIDUES ON SMT3, NUCLEAR, PROTEIN BINDING-DNA BINDING PROTEIN complex
Deposited on 2011-12-18, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: D9719.15, SMT3, YDR510W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v62a_
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: POL30, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (0-End)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d3v62b1, d3v62b2
  • Chain 'C':
    Compound: ATP-dependent DNA helicase SRS2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HPR5, J0913, RADH, SRS2, YJL092W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: D9719.15, SMT3, YDR510W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v62d_
  • Chain 'E':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: POL30, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (0-End)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d3v62e1, d3v62e2
  • Chain 'F':
    Compound: ATP-dependent DNA helicase SRS2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: HPR5, J0913, RADH, SRS2, YJL092W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NEQ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v62A (A:)
    gshmrpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqa
    dqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v62A (A:)
    pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
    dldmedndiieahreqigg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v62B (B:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v62B (B:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3v62D (D:)
    gshmrpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqa
    dqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v62D (D:)
    pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
    dldmedndiieahreqigg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3v62E (E:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v62E (E:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfn
    

  • Chain 'F':
    No sequence available.