PDB entry 3v60

View 3v60 on RCSB PDB site
Description: Structure of S. cerevisiae PCNA conjugated to SUMO on lysine 164
Class: protein binding/DNA binding protein
Keywords: UBIQUITIN-LIKE PROTEIN PCNA, POST-TRANSLATIONAL MODIFICATION DNA REPLICATION DNA DAMAGE RESPONSE, SRS2, NUCLEAR, PROTEIN BINDING-DNA BINDING PROTEIN complex
Deposited on 2011-12-18, released 2012-02-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: D9719.15, SMT3, YDR510W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v60a_
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: POL30, YBR0811, YBR088C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15873 (0-End)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d3v60b1, d3v60b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v60A (A:)
    gshmrpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqa
    dqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v60A (A:)
    pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
    dldmedndiieahreqigg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v60B (B:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfndee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v60B (B:)
    mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
    rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
    idadflgieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsv
    iikpfvdmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfd
    lksgflqfflapkfnd