PDB entry 3v5o

View 3v5o on RCSB PDB site
Description: Structural and Mechanistic Studies of Catalysis and Sulfa Drug Resistance in Dihydropteroate Synthase
Class: transferase
Keywords: Tim Barrel, TRANSFERASE, DHPP and pABA
Deposited on 2011-12-16, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:592021]
    Gene: folP, BAA_0084
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3P9L8
      • engineered mutation (203)
    Domains in SCOPe 2.07: d3v5oa_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:592021]
    Gene: folP, BAA_0084
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3P9L8
      • engineered mutation (203)
    Domains in SCOPe 2.07: d3v5ob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v5oA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniilnpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v5oA (A:)
    kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
    igsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia
    evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniilnpgigfakt
    peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef
    vrvhdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v5oB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniilnpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v5oB (B:)
    kwdydlrcgeytlnlnektlimgilnvtpdggsynevdaavrhakemrdegahiidigsv
    eeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaa
    hydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniilnpgigfaktpeqn
    leamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvh
    dvkemsrmakmmdamigk