PDB entry 3v58

View 3v58 on RCSB PDB site
Description: Crystal Structure of the B-phycoerythrin from the red algae Porphyridium Cruentum at pH5
Class: photosynthesis
Keywords: globin-like, Globin fold, Photosynthetic Antenna, PHOTOSYNTHESIS
Deposited on 2011-12-16, released 2012-10-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycoerythrin alpha subunit
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: phycoerythrin beta subunit
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3v58b_
  • Chain 'C':
    Compound: Phycoerythrin alpha subunit
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3v58c_
  • Chain 'D':
    Compound: phycoerythrin beta subunit
    Species: Porphyridium purpureum [TaxId:35688]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v58B (B:)
    mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
    cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
    gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v58C (C:)
    mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
    akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
    nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals
    

  • Chain 'D':
    No sequence available.