PDB entry 3v58
View 3v58 on RCSB PDB site
Description: Crystal Structure of the B-phycoerythrin from the red algae Porphyridium Cruentum at pH5
Class: photosynthesis
Keywords: globin-like, Globin fold, Photosynthetic Antenna, PHOTOSYNTHESIS
Deposited on
2011-12-16, released
2012-10-03
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-10-03, with a file datestamp of
2012-09-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Phycoerythrin alpha subunit
Species: Porphyridium purpureum [TaxId:35688]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: phycoerythrin beta subunit
Species: Porphyridium purpureum [TaxId:35688]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3v58b_ - Chain 'C':
Compound: Phycoerythrin alpha subunit
Species: Porphyridium purpureum [TaxId:35688]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3v58c_ - Chain 'D':
Compound: phycoerythrin beta subunit
Species: Porphyridium purpureum [TaxId:35688]
Database cross-references and differences (RAF-indexed):
- Heterogens: PEB, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3v58B (B:)
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3v58C (C:)
mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals
- Chain 'D':
No sequence available.