PDB entry 3v4m

View 3v4m on RCSB PDB site
Description: Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
Class: RNA binding protein
Keywords: Canonical RNA binding protein, RNA Splicing, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology
Deposited on 2011-12-15, released 2012-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Mus musculus [TaxId:10090]
    Gene: BC043071, U2af2, U2af65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26369 (1-104)
      • leader sequence (0)
    Domains in SCOPe 2.05: d3v4ma_
  • Chain 'B':
    Compound: splicing factor u2af 65 kda subunit
    Species: Mus musculus [TaxId:10090]
    Gene: BC043071, U2af2, U2af65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3v4mb_
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3v4mA (A:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3v4mB (B:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

    Sequence, based on observed residues (ATOM records): (download) 
    >3v4mB (B:)
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw