PDB entry 3v4m
View 3v4m on RCSB PDB site
Description: Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from Mus musculus at 1.80 A resolution
Class: RNA binding protein
Keywords: Canonical RNA binding protein, RNA Splicing, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology, TCELL
Deposited on
2011-12-15, released
2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-11-08, with a file datestamp of
2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: splicing factor u2af 65 kda subunit
Species: Mus musculus [TaxId:10090]
Gene: BC043071, U2af2, U2af65
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3v4ma1, d3v4ma2 - Chain 'B':
Compound: splicing factor u2af 65 kda subunit
Species: Mus musculus [TaxId:10090]
Gene: BC043071, U2af2, U2af65
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3v4mb_ - Heterogens: CL, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3v4mA (A:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3v4mB (B:)
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
Sequence, based on observed residues (ATOM records): (download)
>3v4mB (B:)
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw