PDB entry 3v4k

View 3v4k on RCSB PDB site
Description: First-In-Class Small Molecule Inhibitors of the Single-strand DNA Cytosine Deaminase APOBEC3G
Class: hydrolase
Keywords: APOBEC3G, ANTIVIRAL DEFENSE, HOST-VIRUS INTERACTION, HYDROLASE, METAL-BINDING, Nucleus
Deposited on 2011-12-15, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA dC->dU-editing enzyme APOBEC-3G
    Species: Homo sapiens [TaxId:9606]
    Gene: APOBEC3G, MDS019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC16 (Start-202)
      • engineered mutation (56)
      • engineered mutation (65)
      • engineered mutation (132)
      • engineered mutation (178)
    Domains in SCOPe 2.07: d3v4ka_
  • Chain 'B':
    Compound: DNA dC->dU-editing enzyme APOBEC-3G
    Species: Homo sapiens [TaxId:9606]
    Gene: APOBEC3G, MDS019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC16 (Start-202)
      • engineered mutation (56)
      • engineered mutation (65)
      • engineered mutation (132)
      • engineered mutation (178)
    Domains in SCOPe 2.07: d3v4kb_
  • Heterogens: CL, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v4kA (A:)
    gplgspefelgtteilrhsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnq
    rrgflanqaphkhgflegrhaelcfldvipfwkldldqdyrvtcftswspcfscaqemak
    fisknkhvslciktariyddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgap
    fqpwdgldehsqdlsgrlrailq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4kA (A:)
    hsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnqrrgflanqaphkhgfle
    grhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktari
    yddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgr
    lrailq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v4kB (B:)
    gplgspefelgtteilrhsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnq
    rrgflanqaphkhgflegrhaelcfldvipfwkldldqdyrvtcftswspcfscaqemak
    fisknkhvslciktariyddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgap
    fqpwdgldehsqdlsgrlrailq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4kB (B:)
    hsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnqrrgflanqaphkhgfle
    grhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslciktari
    yddqgrcqeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqdlsgr
    lrailq