PDB entry 3v4e

View 3v4e on RCSB PDB site
Description: Crystal Structure of the galactoside O-acetyltransferase in complex with CoA
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, galactoside O-acetyltransferase, CoA, TRANSFERASE
Deposited on 2011-12-14, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactoside o-acetyltransferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v4ea_
  • Chain 'B':
    Compound: galactoside o-acetyltransferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v4eb_
  • Chain 'C':
    Compound: galactoside o-acetyltransferase
    Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v4ec_
  • Heterogens: PEG, PGE, COA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v4eA (A:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4eA (A:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v4eB (B:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4eB (B:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3v4eC (C:)
    snamtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtt
    tdnvsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathpln
    fhhrnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnp
    ckvvrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4eC (C:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndl