PDB entry 3v3e

View 3v3e on RCSB PDB site
Description: Crystal Structure of the Human Nur77 Ligand-binding Domain
Class: transcription
Keywords: orphan nuclear receptor, TRANSCRIPTION
Deposited on 2011-12-13, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.199
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor subfamily 4 group A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v3ea_
  • Chain 'B':
    Compound: Nuclear receptor subfamily 4 group A member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR4A1, GFRP1, HMR, NAK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v3eb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v3eA (A:)
    mskpkqppdaspanlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydl
    lsgslevirkwaekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglv
    lhrlqcargfgdwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqn
    riasclkehvaavagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiid
    kifmdtlpflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3eA (A:)
    panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
    aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
    dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
    avagasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v3eB (B:)
    mskpkqppdaspanlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydl
    lsgslevirkwaekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglv
    lhrlqcargfgdwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqn
    riasclkehvaavagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiid
    kifmdtlpflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3eB (B:)
    panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
    aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
    dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
    avagepqasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf