PDB entry 3v3b

View 3v3b on RCSB PDB site
Description: Structure of the Stapled p53 Peptide Bound to Mdm2
Class: ligase/ligase inhibitor
Keywords: oncoprotein, cell cycle, DNA repair, cancer, p53-derived peptide, aliphatic staple, ligase-ligase inhibitor complex
Deposited on 2011-12-13, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v3ba_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v3bb_
  • Chain 'C':
    Compound: SAH-p53-8 stapled-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3V3B
  • Chain 'D':
    Compound: SAH-p53-8 stapled-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3V3B (Start-15)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v3bA (A:)
    mqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3bA (A:)
    qetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
    dlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v3bB (B:)
    mqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v3bB (B:)
    qetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
    dlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.