PDB entry 3v2r

View 3v2r on RCSB PDB site
Description: COMPcc in complex with fatty acids
Class: protein binding
Keywords: coiled coil oleic acid, storage, PROTEIN BINDING
Deposited on 2011-12-12, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2R (0-44)
    Domains in SCOPe 2.07: d3v2ra_
  • Chain 'B':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2R (0-44)
    Domains in SCOPe 2.07: d3v2rb_
  • Chain 'C':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2R (0-44)
    Domains in SCOPe 2.07: d3v2rc_
  • Chain 'D':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2R (0-44)
    Domains in SCOPe 2.07: d3v2rd_
  • Chain 'E':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2R (0-44)
    Domains in SCOPe 2.07: d3v2re_
  • Heterogens: OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2rA (A:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2rB (B:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2rC (C:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2rD (D:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2rE (E:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac