PDB entry 3v2r
View 3v2r on RCSB PDB site
Description: COMPcc in complex with fatty acids
Class: protein binding
Keywords: coiled coil oleic acid, storage, PROTEIN BINDING
Deposited on
2011-12-12, released
2013-01-16
The last revision prior to the SCOPe 2.03 freeze date was dated
2013-01-16, with a file datestamp of
2013-01-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.201
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3v2ra_ - Chain 'B':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3v2rb_ - Chain 'C':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3v2rc_ - Chain 'D':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3v2rd_ - Chain 'E':
Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3v2re_ - Heterogens: OLA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2rA (A:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2rB (B:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2rC (C:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2rD (D:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3v2rE (E:)
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac