PDB entry 3v2q

View 3v2q on RCSB PDB site
Description: COMPcc in complex with fatty acids
Class: protein binding
Keywords: coiled coil palmitic acid, storage, PROTEIN BINDING
Deposited on 2011-12-12, released 2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2Q (0-44)
    Domains in SCOPe 2.08: d3v2qa_
  • Chain 'B':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2Q (0-44)
    Domains in SCOPe 2.08: d3v2qb_
  • Chain 'C':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2Q (0-44)
    Domains in SCOPe 2.08: d3v2qc_
  • Chain 'D':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2Q (0-44)
    Domains in SCOPe 2.08: d3v2qd_
  • Chain 'E':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2Q (0-44)
    Domains in SCOPe 2.08: d3v2qe_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2qA (A:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2qB (B:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2qC (C:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2qD (D:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2qE (E:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac