PDB entry 3v2n

View 3v2n on RCSB PDB site
Description: COMPcc in complex with fatty acids
Class: protein binding
Keywords: coiled coil fatty acids, storage, PROTEIN BINDING
Deposited on 2011-12-12, released 2013-01-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2N (0-44)
    Domains in SCOPe 2.03: d3v2na_
  • Chain 'B':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2N (0-44)
    Domains in SCOPe 2.03: d3v2nb_
  • Chain 'C':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2N (0-44)
    Domains in SCOPe 2.03: d3v2nc_
  • Chain 'D':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2N (0-44)
    Domains in SCOPe 2.03: d3v2nd_
  • Chain 'E':
    Compound: Cartilage Oligomerization matrix protein (coiled-coil domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V2N (0-44)
    Domains in SCOPe 2.03: d3v2ne_
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2nA (A:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2nB (B:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2nC (C:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2nD (D:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v2nE (E:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac