PDB entry 3v2l

View 3v2l on RCSB PDB site
Description: Structure of Anopheles gambiae odorant binding protein 20 bound to polyethylene glycol
Class: odorant-binding protein
Keywords: odorant binding olfaction, General odorant Binding Protein, Transport, secreted, ODORANT-BINDING PROTEIN
Deposited on 2011-12-12, released 2012-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: AgaP_AGAP005208, OBP20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Q9J3 (1-119)
      • expression tag (0)
    Domains in SCOPe 2.06: d3v2la1, d3v2la2
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3v2lA (A:)
mtveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgk
lnydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp