PDB entry 3v28

View 3v28 on RCSB PDB site
Description: Crystal structure of HPF bound to the 70S ribosome. This PDB entry contains coordinates for the 30S subunit with bound HPF of the 2nd ribosome in the ASU
Class: ribosome
Keywords: ribosome hibernation factor, YhbH, Protein E, stress response, stationary phase, ribosome hibernation, RIBOSOME
Deposited on 2011-12-11, released 2012-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.218
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16S ribosomal RNA
  Species: Thermus thermophilus [TaxId:300852]
  
• Chain 'B':
  Compound: 30S ribosomal protein S2
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80371
• Chain 'C':
  Compound: 30S ribosomal protein S3
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80372
• Chain 'D':
  Compound: 30S ribosomal protein S4
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80373 (Start-208)
• Chain 'E':
  Compound: 30S ribosomal protein S5
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ5
• Chain 'F':
  Compound: 30S ribosomal protein S6
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLP8 (0-End)
• Chain 'G':
  Compound: 30S ribosomal protein S7
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17291 (Start-155)
• Chain 'H':
  Compound: 30S ribosomal protein S8
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ2 (0-137)
• Chain 'I':
  Compound: 30S ribosomal protein S9
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80374
• Chain 'J':
  Compound: 30S ribosomal protein S10
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHN7
• Chain 'K':
  Compound: 30S ribosomal protein S11
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80376
• Chain 'L':
  Compound: 30S ribosomal protein S12
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHN3
• Chain 'M':
  Compound: 30S ribosomal protein S13
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80377
• Chain 'N':
  Compound: 30S ribosomal protein S14
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHQ1 (Start-60)
• Chain 'O':
  Compound: 30S ribosomal protein S15
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJ76 (Start-88)
• Chain 'P':
  Compound: 30S ribosomal protein S16
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJH3 (0-End)
• Chain 'Q':
  Compound: 30S ribosomal protein S17
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHP7
• Chain 'R':
  Compound: 30S ribosomal protein S18
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SLQ0
• Chain 'S':
  Compound: 30S ribosomal protein S19
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SHP2
• Chain 'T':
  Compound: 30S ribosomal protein S20
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80380
• Chain 'U':
  Compound: 30S ribosomal protein Thx
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SIH3
• Chain 'X':
  Compound: Probable sigma(54) modulation protein
  Species: Escherichia coli [TaxId:83333]
  Gene: b3203, hpf, JW3170, yhbH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AFX0 (0-94)
  Domains in SCOPe 2.05: d3v28x_
• Heterogens: MG, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.
  
  
• Chain 'T':
  No sequence available.
  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >3v28X (X:)
  mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
  ihasaegqdmyaaidglidklarqltkhkdklkqhhhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3v28X (X:)
  mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
  ihasaegqdmyaaidglidklarqltkhkdklkqh