PDB entry 3v1p

View 3v1p on RCSB PDB site
Description: Crystal structure of the mutant Q185A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
Class: lyase/lyase inhibitor
Keywords: tim barrel, orotidine 5'-monophosphate decarboxylase, inhibitor BMP, LYASE, LYASE-LYASE INHIBITOR complex
Deposited on 2011-12-09, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.166
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3v1pa_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3v1pb_
  • Heterogens: BMP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v1pA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaaggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v1pA (A:)
    dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr
    iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem
    shpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaag
    gdpgetlrfadaiivgrsiyladnpaaaaagiiesikdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v1pB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaaggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v1pB (B:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaaggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdll