PDB entry 3v17

View 3v17 on RCSB PDB site
Description: Crystal structure of the Fe(II)/alpha-ketoglutarate dependent taurine dioxygenase from Pseudomonas putida KT2440
Class: oxidoreductase
Keywords: jelly roll motif, dioxygenase, Fe(II), alpha-ketoglutarate, taurine, OXIDOREDUCTASE
Deposited on 2011-12-09, released 2012-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP0230, PP_0230, tauD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v17a_
  • Chain 'B':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP0230, PP_0230, tauD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v17b_
  • Chain 'C':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP0230, PP_0230, tauD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v17c_
  • Chain 'D':
    Compound: Alpha-Ketoglutarate-Dependent Taurine Dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP0230, PP_0230, tauD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v17d_
  • Heterogens: AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v17A (A:)
    msltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaa
    rfgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpay
    ggdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnp
    plshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqe
    ndvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v17A (A:)
    sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
    fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
    gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
    lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
    dvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v17B (B:)
    msltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaa
    rfgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpay
    ggdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnp
    plshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqe
    ndvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v17B (B:)
    sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
    fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
    gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
    lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
    dvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3v17C (C:)
    msltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaa
    rfgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpay
    ggdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnp
    plshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqe
    ndvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v17C (C:)
    sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
    fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
    gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
    lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
    dvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3v17D (D:)
    msltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaa
    rfgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpay
    ggdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnp
    plshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqe
    ndvafwdnrvtqhfavddyrpnrrvmhratilgdapf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v17D (D:)
    sltitplspalgaqisgvdisrdisaeerdaieqallqhqvlflrdqpinpeqqarfaar
    fgdlhihpiypnvpdtpqvlvldtavtdvrdnavwhtdvtflptpalgavlsakqlpayg
    gdtlwasgiaafealsaplremldgltathdftksfplerfgttpqdlarweatrrnnpp
    lshpvvrthpvsgrkalfvnegfttrinelselesdallrllfahatrpefsirwrwqen
    dvafwdnrvtqhfavddyrpnrrvmhratilgdapf