PDB entry 3v0x

View 3v0x on RCSB PDB site
Description: Bovine trypsin variant X(tripleGlu217Phe227) in complex with small molecule inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: Trypsin-like serine protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-12-09, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (96)
      • engineered mutation (151-154)
      • engineered mutation (162)
      • engineered mutation (171)
      • engineered mutation (194)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d3v0xa_
  • Heterogens: CA, ANH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3v0xA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcvgyleggkdacqgdsggp
vvcsgklqgivswgegcaqknkpgfytkvcnyvswikqtiasn