PDB entry 3v0w

View 3v0w on RCSB PDB site
Description: Crystal structure of Fab WN1 222-5 in complex with LPS
Class: immune system
Keywords: Beta barrel, Antibody, Fab, IMMUNE SYSTEM
Deposited on 2011-12-08, released 2012-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: WN1 222-5 Fab (IgG2a) heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0W (0-218)
  • Chain 'L':
    Compound: WN1 222-5 Fab (IgG2a) light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0W (0-End)
    Domains in SCOPe 2.07: d3v0wl1, d3v0wl2
  • Heterogens: SO4, PA1, GLC, GLA, GM0, GMH, KDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3v0wL (L:)
    diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
    rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleikrgdaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v0wL (L:)
    diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
    rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleikrgdaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr