PDB entry 3v0v

View 3v0v on RCSB PDB site
Description: Fab WN1 222-5 unliganded
Class: immune system
Keywords: Beta sheets, Antibody, Fab, IMMUNE SYSTEM
Deposited on 2011-12-08, released 2012-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.24
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WN1 222-5 Fab (IgG2a) heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0V (0-219)
  • Chain 'B':
    Compound: WN1 222-5 Fab (IgG2a) light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0V (0-211)
    Domains in SCOPe 2.07: d3v0vb1, d3v0vb2
  • Chain 'H':
    Compound: WN1 222-5 Fab (IgG2a) heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0V (0-End)
  • Chain 'L':
    Compound: WN1 222-5 Fab (IgG2a) light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3V0V (0-211)
    Domains in SCOPe 2.07: d3v0vl1, d3v0vl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v0vB (B:)
    diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
    rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleikrgdaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3v0vL (L:)
    diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
    rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleikrgdaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrg