PDB entry 3v08

View 3v08 on RCSB PDB site
Description: Crystal structure of Equine Serum Albumin
Class: transport protein
Keywords: allergen, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, carrier protein, TRANSPORT PROTEIN
Deposited on 2011-12-07, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v08a1, d3v08a2, d3v08a3
  • Heterogens: BR, SO4, EDO, UNX, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v08A (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgredkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v08A (A:)
    hkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaenc
    dkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaq
    caafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipkld
    alkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhk
    ecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlp
    alaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccae
    adppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptl
    veigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslae
    rrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeq
    lktvlgnfsafvakccgredkeacfaeegpklvassqlala