PDB entry 3uzz

View 3uzz on RCSB PDB site
Description: Crystal structure of 5beta-reductase (AKR1D1) E120H mutant in complex with NADP+ and delta4-androstenedione
Class: oxidoreductase
Keywords: ALDO-KETO REDUCTASE, STEROID AND BILE ACID METABOLISM, CATALYTIC TETRAD MUTANT, Tim Barrel, OXIDOREDUCTASE
Deposited on 2011-12-07, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxo-5-beta-steroid 4-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1D1, SRD5B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51857 (Start-345)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d3uzza_
  • Chain 'B':
    Compound: 3-oxo-5-beta-steroid 4-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1D1, SRD5B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51857 (Start-345)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d3uzzb_
  • Heterogens: NAP, TES, CL, ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3uzzA (A:)
    mgsshhhhhhssglvprgshmdlsaashriplsdgnsipiiglgtysepkstpkgacats
    vkvaidtgyrhidgayiyqnehevgeairekiaegkvrredifycgklwatnhvpemvrp
    tlertlrvlqldyvdlyiihvpmafkpgdeiyprdengkwlyhksnlcatweameackda
    glvkslgvsnfnrrqlelilnkpglkhkpvsnqvechpyftqpkllkfcqqhdivitays
    plgtsrnpiwvnvssppllkdallnslgkrynktaaqivlrfniqrgvvvipksfnleri
    kenfqifdfslteeemkdiealnknvrfvellmwrdhpeypfhdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzzA (A:)
    dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
    hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiihv
    pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
    kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
    allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
    lnknvrfvellmwrdhpeypfhdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3uzzB (B:)
    mgsshhhhhhssglvprgshmdlsaashriplsdgnsipiiglgtysepkstpkgacats
    vkvaidtgyrhidgayiyqnehevgeairekiaegkvrredifycgklwatnhvpemvrp
    tlertlrvlqldyvdlyiihvpmafkpgdeiyprdengkwlyhksnlcatweameackda
    glvkslgvsnfnrrqlelilnkpglkhkpvsnqvechpyftqpkllkfcqqhdivitays
    plgtsrnpiwvnvssppllkdallnslgkrynktaaqivlrfniqrgvvvipksfnleri
    kenfqifdfslteeemkdiealnknvrfvellmwrdhpeypfhdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3uzzB (B:)
    dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
    hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiihv
    pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
    kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
    allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
    lnknvrfvellmwrdhpeypfhdey